PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G002897.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family LBD
Protein Properties Length: 277aa    MW: 30325 Da    PI: 7.1315
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G002897.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260121.35.3e-3810108199
                DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                           +CaaCk+lrrkC ++C++apyfp++qp+kfa vh+++G+ nv k+l+ ++  +re+a++sl+yeA+ar+rdPvyG++g+i+ l+++l++
  HL.SW.v1.0.G002897.1  10 PCAACKFLRRKCMPGCIFAPYFPSDQPQKFASVHRIYGTGNVAKILNGINVAHREEAVNSLAYEAQARLRDPVYGVIGFISILHNHLNH 98 
                           7**************************************************************************************** PP

                DUF260  90 lkaelallke 99 
                           ++a l+ + +
  HL.SW.v1.0.G002897.1  99 ARARLNNASN 108
                           ***9998776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.4069110IPR004883Lateral organ boundaries, LOB
PfamPF031952.3E-3710106IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MNIPPPPPPP CAACKFLRRK CMPGCIFAPY FPSDQPQKFA SVHRIYGTGN VAKILNGINV  60
AHREEAVNSL AYEAQARLRD PVYGVIGFIS ILHNHLNHAR ARLNNASNDL GGHTSPHPQP  120
QSQKIINPPP NGVPPMPNLE VNPNHQQQRQ QPQPQLRPFC FENIPRPQHP QQQMISNITF  180
DYIGEGGPFG PMVNPDMMEH YNSQMLMAGS IFNRGGGGGS SSVAATDGAC ESNNNNTNLN  240
GQLMQPNQID ALHDSSLDHQ LQSQLMLNSP NNNDEN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGVIT_00s1247g00010.t012e-44(Vitis vinifera)
STRINGVIT_07s0197g00020.t013e-44(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.12e-41ASYMMETRIC LEAVES 2-like 1